Эксперт по ферментам разоблачает ошибочность эволюции

Джонатан Сарфати беседует с финским биохимиком, доктором Матти Лейсола

Доктор Матти Лейсола

Доктор Матти Лейсола получил степень доктора технических наук (Технология) в области биотехнологии в 1979 году в Хельсинки (Финляндия) в Технологическом университете. В 1987 году ему была присуждена премия Лациса за значительный вклад в развитие швейцарской науки. Он занимал должность директора по исследованиям (1988-1997 гг.) в международной биотехнологической компании, а в последнее время является деканом факультета химических наук и материаловедения в финском университете Аалто. За свою научную карьеру д-р Лейсола опубликовал более 120 работ, главным образом на тему исследования ферментов, и 20 статей, напечатанных в книгах или протоколах конференций. Он также получил шесть патентов. В научной литературе можно найти 1300 упоминаний научных статей д-ра Лейсола.

Доктор Лейсола принимал участие в создании документального фильма о Дарвине «Путешествие, которое потрясло мир» (англ. The Voyage that Shook the World, 2009). Но в научных кругах он больше известен за свои исследования ферментов. Сам д-р Лейсола говорит:

«Мне нравится называть ферменты ‘орудиями жизни’. Это своего рода белки - макромолекулы (большие молекулы), состоящие из специально расположенных аминокислот. Их можно назвать катализаторами жизни, которые значительно ускоряют химическую реакцию в живых клетках. Ферменты распознают, преобразуют, передают, транспортируют, окисляют, восстанавливают, соединяют и разделяют молекулы».

Инструкции по образованию ферментов закодированы в нашей ДНК. Так же как русский алфавит состоит из 33 букв, так же и алфавит ферментов включает 20 биохимических ‘букв’ (аминокислот), каждая из которых закодирована в языке ДНК (который имеет четыре разные буквы) ‘словами’ из трех букв. К примеру, комбинация ‘Матти Лейсола’ состоит из 12 букв и одного пробела. «Это настолько специфическое сочетание, что люди могут легко найти меня, так как никто из моих знакомых не имеет больше такого имени. В среднем фермент состоит примерно из 300 биохимических букв. Благодаря этому каждый из них предназначен для выполнения определенной задачи».

Модель фермента ксиланаза

stockphoto.com

Модель фермента ксиланаза — сложный механизм, состоящий из точной последовательности аминокислот.

Группа ученых во главе с Матти изучила фермент «ксиланаза» (см. схему выше). Этот энзим разрушает один из наиболее распространенных на земле углеводородных полимеров «ксилан», который содержится в стенках растительной клетки. Береза на 30 % состоит именно из этого фермента. Ксиланаза включает около 200 аминокислот. Ее белковый код – предложение, означающее «разрушь ксилан». У млекопитающих нет этого фермента, поэтому они не могут переваривать ксилан.

Если использовать разные буквы для разных аминокислот, белковое «предложение» можно записать следующим образом:

ASINYDQNYQTGGQVSYSPSNTGFSVNWNTQDDFVVGVGWTGSS
APINFGGSFSVNSGTGLLSVYGWSTNPLVEYYIMEDNHNYPAQGTVK
GTVTSDGATYTIWENTRVNEPSIQGTATFNQYISVRNSPRTSGTVTVQ
NHFNAWASLGLHLGQMNYQVVAVEGWGGSGSASQSVSN

Именно эта последовательность позволяет молекулярному механизму выполнять свою задачу, и у каждого фермента она индивидуальна. Никакие химические или физические свойства не могут заставить аминокислоты ксиланазы размещаться в правильном положении. Порядок, т.е. информация, передается через последовательность, в которой собраны аминокислоты по запрограммированным внутри клетки инструкциям.

Отвергая эволюцию

Известно, что д-р Лейсола скептически относится к эволюции от молекулы к человеку, называя её «рассказыванием сказок». Но он не всегда так думал. Вот что он сам говорит:

«До того как мне исполнилось 22 года, я верил в стандартную историю. Я пользовался ею (так я думал тогда) как мощным орудием для того, чтобы выступать против Бога христиан. Сам того не осознавая, я был типичным продуктом западной системы натуралистического образования. Кончено же, я хотел оставаться независимым, и мне фактически не нравилась идея о том, что Бог может мешать моей жизни».

Но благодаря своей девушке, а впоследствии жене, Матти изменился:

«Она стала христианкой и передо мной внезапно возникла реальность её измененной жизни и новых ценностей. Я начал исследовать свидетельства, доказывающие христианство. Мои исследования привели меня к Христу. Затем я хотел понять, насколько сильно орудие дарвинизма против христианства. Мне не стоило больших усилий, чтобы увидеть, что дарвинизм основан на очень слабом основании. Впервые я осознал это, когда начал исследовать биохимию и с помощью нескольких элементарных экспериментов пытался объяснить происхождение жизни. Всё началось с изменения моей системы верований. Каждый человек имеет такую систему и использует её, чтобы объяснить факты, но в действительности дело вовсе не в фактах».

Д-р Матти Лейсола со своей женой Марией

Д-р Матти Лейсола со своей женой Марией. У них четверо детей и пять внуков.

Исследования в области ферментов решительно оспаривают эволюцию и указывают на Создателя. По словам Лейсола, в отличие от общепринятого мнения, нет никакого разумного натуралистического объяснения происхождению богатых информацией и функциональных молекул или изменению одних в другие: «Очень трудно получить последовательность букв ‘Матти Лейсола’ путем какого-то случайного процесса. И уж куда более сложно получить биохимическую последовательность букв для ксиланазы». Даже самым простым живым организмам необходимо более 350 функциональных ферментов1 таких же сложных как ксиланаза. Что касается теорий происхождения жизни, то естественный отбор не способен объяснить происхождение жизненно важных ферментов, так как естественный отбор действует на самовоспроизводящиеся организмы, а значит, они не могут использоваться для объяснения их происхождения.2

Матти также отмечает: «В мире животных существуют тысячи взаимосвязанных и тщательно регулируемых функций. Это происходит на многих уровнях: на уровне отдельной клетки, многоклеточного организма, симбиотических отношений, групповых разумных и коммуникационных систем, например, у муравьев и пчел, а также сбалансированной экосистемы. И все эти замечательные вещи кодируются только четырьмя буквами ДНК. Дизайн начинается с процесса мышления и Разума, способного одновременно планировать и поддерживать работу этой огромной, невероятно сложной целостной системы: от мельчайших деталей до всей своей полноты. Эта система полностью находится за пределами нашего ограниченного понимания. Мы должны смиренно склониться перед таким величием и признать, что мы на самом деле ничего. В Псалме 91:6-7 говорится о Божьем Сотворении: ‘Как велики дела Твои, Господи! дивно глубоки помышления Твои! Человек несмысленный не знает, и невежда не разумеет того’».

Реальная наука против эволюции

Когда Матти впервые начал сомневаться в эволюции, он только начинал свою научную карьеру. Он подходил к своим преподавателям и спрашивал их о том, каким образом эволюция могла создать все биологические новшества:

У них, конечно же, в запасе были истории, но когда дело доходило до механизмов эволюции (что и составляет всю науку), они не могли ничего объяснить.

«У них, конечно же, в запасе были истории, но когда дело доходило до механизмов эволюции (что и составляет всю науку), они не могли ничего объяснить. Позднее на научных конференциях, посвященных ферментам, я стал говорить о том, что случайное изменение имеет границы и до сих пор все со мной согласны».

Опубликовавший более ста работ и упоминаемый в научных трудах, д-р Лейсола часто может услышать в свой адрес фразу: «Ни один настоящий ученый не станет отрицать эволюцию». Но утверждающий подобное в действительности заменяет «науку» «натурализмом». Матти говорит: «Настоящий ученый ищет правду о природе, а не натуралистические объяснения».

Но разве вера в Сотворение не наносит науке вред? Наоборот! Д-р Лейсола признает:

«Христианство является основанием современной науки и объясняет, почему мы можем заниматься наукой: разумный Бог сотворил разумного человека по Своему образу, чтобы он мог постичь своими умом Божье творение. Творец Иисус Христос назван Словом (Иоанна 1:1–3), и Он разбирается в этой упорядоченной вселенной и сложности жизни. Тот, кто верит в натуралистическое объяснение происхождения жизни, имеет слепую веру».

Эволюция от бактерии до биолога не имеет под собой никаких научных оснований. Тем не менее, многие ученые уверены, имитация эволюции, т.е. случайные изменения и естественный отбор, дали возможность образовываться новым ферментам.3 Однако д-р Лейсола специалист в этой области,4 и он отмечает:

«Даже когда эти методы используются под тщательным контролем, они не образуют ничего кроме незначительных адаптаций или вариаций. Моя исследовательская группа, к примеру, разработала ферменты, которые лучше функционируют в экстремальных условиях, и микроорганизмы, образующие новые молекулы. Однако эти достижения уже с самого начала имели хорошо созданный фермент и управлялись разумом. Более того, всегда есть граница степени изменения. Неудивительно, что живые клетки сопротивляются случайным изменениям, так как они почти всегда ведут к ухудшению».

Почему Сотворение имеет значение?

Доктор Лейсола перевел на финский язык ряд книг по креационизму, а также текст нашего фильма о Дарвине. Он также организовал поездки в Финляндию многих известных креационистов, как например, трижды доктора A.E. Уайлдера-Смита (1915–1995). Так почему же это так важно?

Сотворение помогает нам понять наше место и роль во вселенной.

Доктор Лейсола: «Все люди рано ли поздно задаются вопросом, ‘Откуда мы?’ Апостол Павел пишет в своем послании к Римлянам 1, что невидимые качества Бога явно видны в Его делах, и тому, кто отрицает Его существование, нет оправдания. Сотворение помогает нам понять наше место и роль во вселенной». Оно также важно для того, чтобы мы понимали, что такое добро и зло. Д-р Лейсола активно занимается вопросами этической стороны биотехнологии.5 Он согласен с агностиком, эволюционным философом Майклом Рузом, который сказал, что если бы эволюция была истинной, этика была бы не более чем иллюзией:

«Без абсолютных ценностей не может существовать никаких этических стандартов. Это хорошо видно в том, как развивается наша западная культура. Когда со сцены уходит христианское согласие, общество беззащитно в попытке навязать людям правила. Всё больше и больше людей хотят своего и все меньше и меньше задаются вопросом, что хорошо, а что плохо».

Матти повторяет слова апостола Павла: «Я не стыжусь Евангелия — оно дает ответы на важные вопросы, на которые никакие другие системы ответить не могут: каково происхождение вселенной и жизни, на чем основывается уникальность человека и его нормы нравственности, и что является прочным основанием равной значимости всех людей и ценности каждого человека. Современный человек озадачен, потому что не знает, как ответить на эти вопросы».

В конце нашей беседы я спросил д-ра Лейсола, что бы он мог посоветовать молодым людям, которые хотят заниматься наукой:

«Лучшие советы нам дает Библия. Будьте всегда готовы рассказать о том, почему вы верите (1 Петра 3:15). Не стыдитесь Евангелия, потому что в нем содержатся ответы для людей (Римлянам 1:16). Будьте мудры как змеи и просты как голуби (Матфея 10:16). Не волнуйтесь, когда мир вас ненавидит за Иисуса, ведь это хороший знак (Иоанна 15:18–20)».

Ссылки и примечания

  1. Исследование, которое проводили Гамильтон Смит в институте им. Д. Крейга Вентера в г. Роквиль, показывает, что минимальный геном состоит из 387 белок-кодирующих и 43 РНК-кодирующих генов // Nature 439, 246–247 (19 января, 2006) | doi:10.1038/439246a; Proc. Natl Acad. Sci. USA 103:425–430, 2006). Вернуться к тексту.
  2. К примеру, исследователь Ричард Вулфенден говорит об этом «белом пятне» так: «Без катализаторов жизнь, от микроорганизмов до людей, вообще не могла бы существовать. Становится интересно, каким образом естественный отбор работал так, что образовал белок, который начал действовать как примитивный катализатор для такой удивительно медленной реакции». Процитировано: Ланг, Л.Г., «Without Enzyme Catalyst, Slowest Known Biological Reaction Takes 1 Trillion Years» // Biocompare Life Science News, 5 мая, 2003. Также смотрите «Natural selection cannot explain the origin of life». Вернуться к тексту.
  3. Похожее заявление смотрите у Баттена, Д., «Genetic algorithms and robotic folly» // J. Creation 14(3):13–15, 2000. Вернуться к тексту.
  4. Лейсола, M. и Турунен, O., «Protein engineering: opportunities and challenges» // Appl. Microbiol. Biotechnol. 75(6):225–232, 2007 | DOI 10.1007/s00253-007-0964-2. Вернуться к тексту.
  5. Лейсола M., «Bioscience, Bioinnovations, and Bioethics» // Adv Biochem Eng / Biotech 107: 41–56, 2007 http://dx.doi.org/10.1007/ 10_2007_052. Оджала, П.Д., Вахакангас, Д.M., Лейсола M., «Evolutionism in the Haeckelian shadow—Harry Federley, the father of the Finnish genetics and eugenics legislation, as a recapitulationist and a Monist propagator» // Yearbook for European Culture of Science 1:61–86, Штуттгард, Германия, 2005. Оджала, П.Д. и Лейсола M., «Haeckel: legacy of fraud to popularise evolution» // J. Creation 21(3):102–110, 2007. Вернуться к тексту.

источник - www.creation.com





опубликовано материалов

Популярные статьи:

что такое гравитация? Кто создал Бога? Динозавры жили с людьми Тука и его удивительный клюв Уникальная планета Земля




Поддержите наш проект, разместив нашу ссылку на сайте своей организации, в своем блоге или на страничке социальных сетей.
"Разумный Замысел"
http://www.origins.org.ua
банер Разумный Замысел


Система Orphus
нижняя полоса сайта